PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AS_94B6230FB1.1
Common NameWLIP19, Wlip19a
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 150aa    MW: 16284.3 Da    PI: 10.333
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AS_94B6230FB1.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.51.7e-142886563
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                  bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                            ++ +r+ +NRe+ArrsR+RK++++eeL  ++  L+aeNk+   ++  ++ e  k++ e+
  Traes_1AS_94B6230FB1.1 28 RKRKRMLSNRESARRSRARKQQRMEELIAEASRLQAENKRVEAQIGAYTTELTKVDGEN 86
                            57899****************************************99999998887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.2E-192488IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.1E-122582No hitNo description
PROSITE profilePS5021711.5072689IPR004827Basic-leucine zipper domain
PfamPF001701.8E-102881IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.75E-112881No hitNo description
PROSITE patternPS0003603146IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MSSPSRRSSS PESNIDGGSG SGSAGDERKR KRMLSNRESA RRSRARKQQR MEELIAEASR  60
LQAENKRVEA QIGAYTTELT KVDGENAVLR ARHGELAGRL QALGGVLEIF QVAGAPVDIP  120
EIPDPLLRPW QSPFAPQLAT AGGMPDAFQF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14047RRSRARKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1935520.0AB193552.1 Triticum aestivum WLIP19 mRNA for bZIP transcription factor, complete cds.
GenBankAB3341270.0AB334127.1 Triticum aestivum Wlip19a mRNA for basic region/leucine zipper protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569062.12e-70PREDICTED: ocs element-binding factor 1-like
TrEMBLQ53UC71e-104Q53UC7_WHEAT; BZIP transcription factor
STRINGMLOC_52125.11e-75(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188635100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.17e-22basic region/leucine zipper motif 53
Publications ? help Back to Top
  1. Kobayashi F, et al.
    Development of abiotic stress tolerance via bZIP-type transcription factor LIP19 in common wheat.
    J. Exp. Bot., 2008. 59(4): p. 891-905
    [PMID:18326864]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]